Home Takara Clontech Logo Takara Clontech
login | register | order now | view cart | feedback
Cell Biology

Products >  Cell_Biology >  Bone_Research >  Antibodies >  Bone_Specific_Alkaline_Phosphatase_Rat_Polyclonal

Bone Alkaline Phosphatase (Rat), Polyclonal Antibody

Bone Alkaline Phosphatase, also known as Bone Specific Alkaline Phosphatase, is expressed in osteoblasts during bone formation and is thought to play a role in skeletal mineralization. Takara's Bone Specific Alkaline Phosphatase (Rat) Polyclonal Antibody was raised against a conjugate of the KLH (keyhole limpet hemocyanin) immunogen and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN], which is highly conserved between human and rat bone specific alkaline phosphatase.

  At-A-Glance   Documents   Images & Data   Resources


  • Specificity: Rat Bone Specific Alkaline Phosphatase
  • Cross reactivity:
    -- Mouse antigens
    -- Human antigens (slight reactivity) 
  • Form: Lyophilized


  • Western blot analysis (non-reducing conditions)
  • Immunohistochemical detection of paraffin embedded tissue sections (no antigen retrieval needed)

Alternative names

AKP2, alkaline phosphatase, alkaline phosphatase liver/bone/kidney isozyme antibody, Alpl, AP-TNAP, HOPS, Liver/bone/kidney isozyme, PHOA, PPBT_HUMAN, tissue non specific alkaline phosphatase, tissue nonspecific ALP, tissue-nonspecific isozyme, TNAP, TNSALP



This product does not contain preservative. The stock solution (2.0 mg/mL) should be stored in aliquots at –20 °C  for up to 1 year. Alternately, following addition of 0.1% sodium azide, the stock may be stored at 4 °C  for up to 6 months. Avoid repeated freeze-thaw. Do not store diluted antibody.

Cat. # Product Contents Size Price Units Select
M190 Bone Specific Alkaline Phosphatase (Rat), Polyclonal 0.1 mg $407.00



Clontech is a Takara Bio Company © 2015 Privacy Policy | Terms & Conditions