Takara
login | register | order now | view cart  
Products
Cell Biology
Allergy and Immunology
Apoptosis Kits and Reagents
Bone Research
Cell Adhesion and Extracellular Matrix
Cell Proliferation and Viability
Epigenetics
Miscellaneous
Signal Transduction


Products >  Cell_Biology >  Bone_Research >  Antibodies >  Bone_Specific_Alkaline_Phosphatase_Rat_Polyclonal

Bone Specific Alkaline Phosphatase (Rat), Polyclonal

This product was raised against a conjugate of KLH and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN] that illustrates an exceptional homology with human and rat Bone Specific Alkaline Phosphatase.
At-A-Glance Documents

Features

  • Specificity: This antibody specifically reacts with rat Bone Specific Alkaline Phosphatase
  • Cross reactivity:
    -- This antibody reacts with mouse antigen
    -- This antibody reacts faintly with human antigen
  • Form: Lyophilized

Applications

  • Detection of Bone Specific Alkaline Phosphatase by Western blot analysis under non-reducing condition
  • Immunohistochemical detection on paraffin embedded tissue section
  • No need for antigen retrieval

 

Storage

4°C

This product does not contain preservatives. The stock solution (2.0 mg/mL) should be stored in aliquots at –20℃ for 1 year, or should be stored at 4℃ for 6 months after adding 0.1% sodium azide. Avoid repeated freeze-thaw cycles. Diluted antibody should not be stored.


 
 
Products
New Cat. # Product Package Size Price
M190 Bone Specific Alkaline Phosphatase (Rat), Polyclonal 0.1 mg $399.00
 

 


Clontech is a Takara Bio Company © 2012 Privacy Policy | Terms & Conditions | TRUSTe